• IGF-1LR3 COA151075
1 2

yuansensetech

IGF-1LR3

IGF-1LR3

$45.00
$45.00
Sale Sold out
Shipping calculated at checkout.
Dosage

Product Description

Overview
IGF-1 LR3 is a synthetic research peptide, an 83-amino acid polypeptide engineered as a lengthened analog of human IGF-1. IGF-1 LR3 peptide features an arginine substitution at position 3 and a 13-amino acid N-terminal extension, resulting in a markedly prolonged half-life of approximately 20–30 hours. This IGF-1 LR3 analog exhibits potent mitogenic and anabolic properties widely studied in cell growth, differentiation, and metabolic regulation research.
Mechanism of Action

IGF-1 LR3 exerts its effects by binding to the Type 1 IGF receptor (IGF-1R), which is homologous to the insulin receptor. This receptor activation stimulates intracellular signaling cascades, primarily the PI3K/AKT pathway and the MAPK/ERK pathway (including ERK1/2 signaling). These pathways promote cell proliferation, survival, differentiation, and metabolic processes including the uptake of glucose, fatty acids, and amino acids to support growing tissues. Unlike native IGF-1, IGF-1 LR3 has >100-fold reduced affinity for IGF-binding proteins (IGFBPs), which otherwise sequester native IGF-1 and limit its bioavailability. This structural advantage ensures sustained receptor engagement and enhanced biological potency—approximately three times more potent than native IGF-1.

Research Applications
  • Cell Culture and Bioproduction: Widely used as a serum-free supplement in mammalian cell culture to promote cell growth, proliferation, and recombinant protein expression.
  • Tissue Regeneration and Stem Cell Research: Investigated for stimulating proliferation and survival of various cell types including muscle, bone, and cartilage tissue.
  • Metabolic Research: Employed to study glucose, fatty acid, and amino acid uptake, as well as insulin-like growth factor signaling pathways.
  • Neurobiology: Studied for neuroprotective effects, including amyloid plaque remodeling in the cerebral cortex.
  • Signal Transduction: Utilized to probe PI3K/AKT and MAPK/ERK pathways involved in metabolism, apoptosis, and gene expression.
Product Specifications

CAS Number: 946870-92-4
Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular Weight: 9,117.5 g/mol (9.1 kDa)
Amino Acids: 83 amino acids
Sequence (One-Letter Code): MFPAMPLLSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRELMYCAPLKPAKSA
Purity: ≥ 95%–98% (batch-dependent; refer to Certificate of Analysis)
Form: White to off-white lyophilized powder
Storage: Store at ≤ -20°C in a cool, dry place, protected from light and moisture
Solubility: Soluble in sterile water (≥0.1 mg/mL); prepare working solutions per laboratory protocol

 

View full details

Research Use Only

This product is intended for research purposes only and is not for human consumption, therapeutic use, or diagnostic applications. Please ensure compliance with all applicable regulations and institutional guidelines.