yuansensetech
LL37
LL37
SKU:LL375
Couldn't load pickup availability
Product Description
Overview
LL-37 peptide is a synthetic research peptide material supplied by Yuansense Peptide for laboratory and professional research applications.
LL-37 is a 37-amino-acid peptide derived from the human cathelicidin antimicrobial peptide precursor hCAP18. As a naturally occurring peptide sequence studied in molecular biology and biochemical research, LL-37 is widely used as a reference material for peptide structure, interaction, and cellular research studies.
Yuansense Peptide supplies LL-37 as a high-purity lyophilized powder with supporting quality documentation, including Certificate of Analysis (COA), HPLC testing, and mass spectrometry analysis.
Flexible supply options are available for research institutions, distributors, and professional buyers, including sample orders and bulk peptide supply programs.
Product Information
| CAS Number: | is not separately assigned for synthetic LL-37 peptide material |
| PubChem CID: | Not assigned |
| Molecular Formula: | C205H340N60O53 |
| Molecular Weight: | 4493.3 g/mol |
| Purity: | ≥98.6% (Actual batch purity may vary according to production testing results) |
| Sequence: | [LL-37, 37 aa] |
| Form: | Lyophilized powder |
| Storage: | Store at -20°C or below for long-term storage, protected from light and moisture. Storage conditions may vary depending on product characteristics, handling procedures, and specific experimental requirements. |
| Solubility: | Soluble in water or suitable laboratory buffers. Actual solubility may vary depending on concentration, solvent selection, temperature, and laboratory conditions. |
Technical Specifications
| Peptide Type: | Synthetic Cathelicidin-Derived Peptide |
| Peptide Length: | 37 Amino Acids |
| Origin: | Derived from Human Cathelicidin LL-37 Sequence |
| Appearance: | White Lyophilized Powder |
| Purity: | ≥98.6% (Actual batch purity may vary according to production testing results) |
| Testing Method: | HPLC / Mass Spectrometry |
| Documentation: | Certificate of Analysis (COA), HPLC Testing Report, Mass Spectrometry Data |
Research Applications
- Peptide Structure Research: Used in laboratory studies investigating synthetic peptide properties and molecular characteristics.
- Peptide Interaction Studies: Applied as a reference material for studying peptide interactions and biochemical pathways.
- Cellular Research: Used in experimental research involving peptide-related cellular mechanisms.
- Analytical Research: Suitable for peptide identification, purity evaluation, and structural characterization.
Quality Control & Documentation
Each batch of LL-37 peptide supplied by Yuansense Peptide undergoes quality verification procedures to ensure product consistency and documentation reliability.
- Certificate of Analysis (COA)
- HPLC Purity Testing Report
- Mass Spectrometry Testing Data
- Batch Quality Documentation
Customers may contact our team to request the latest batch documentation.
Packaging & Bulk Supply
Yuansense Peptide provides flexible supply options for LL-37 peptide research material.
- Sample orders for laboratory evaluation
- Multiple vial specifications available
- Bulk peptide supply programs
- Distributor cooperation
- Customized packaging solutions
For larger quantity requirements, please contact our sales team for bulk pricing and supply availability.
Frequently Asked Questions
What is LL-37 peptide?
LL-37 is a synthetic 37-amino-acid peptide research material derived from the human cathelicidin peptide sequence.
What is the peptide sequence of LL-37?
The LL-37 peptide sequence is [LL-37, 37 aa]
What is the molecular weight of LL-37?
The molecular weight of LL-37 is approximately 4493.3 g/mol.
Do you provide COA for LL-37?
Yes. Certificate of Analysis (COA), HPLC reports, and mass spectrometry documentation are available upon request.
Can I order bulk LL-37 peptide?
Yes. Yuansense Peptide supports sample orders and bulk peptide supply programs. Larger quantity buyers can contact our sales team for pricing and availability.
Disclaimer
This product is supplied for research use only (RUO).
It is not intended for human consumption, medical use, diagnosis, treatment, or prevention of any disease.
Important Notice
This product is sold strictly for laboratory research purposes only.It is not intended for human consumption, medical use, or clinical application. By purchasing this product, the buyer confirms that it will be used solely for lawful scientific research.
Research Use Only
This product is intended for research purposes only and is not for human consumption, therapeutic use, or diagnostic applications. Please ensure compliance with all applicable regulations and institutional guidelines.