yuansensetech
Reta (GLP-3)
Reta (GLP-3)
SKU:RT5
4.68 / 5.0
(19) 19 total reviews
Couldn't load pickup availability
Product Description
Overview
Retatrutide is a high-purity synthetic peptide raw material supplied by Yuansense Peptide for laboratory research and professional peptide supply applications.
Retatrutide is provided in lyophilized powder form with supporting quality documentation, including purity testing and Certificate of Analysis (COA).
Yuansense Peptide provides flexible peptide supply solutions for research institutions, distributors, and professional buyers, including sample orders, bulk purchasing, and customized supply requirements.
Product Information
| Product Name | Retatrutide |
| CAS Number | 2381089-83-2 |
| PubChem CID | 171934787 |
| Molecular Formula | C221H342N46O68 |
| Molecular Weight | 4731 g/mol |
| Sequence | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS |
| Purity | ≥98.6% (Actual batch purity may vary according to production testing results) |
| Form | Lyophilized Powder |
| Storage | Store at -20°C or below for long-term storage. Storage conditions may vary depending on product characteristics, handling procedures, and specific experimental requirements. Please refer to product documentation for detailed storage recommendations. |
| Solubility | Solubility information is available based on product characteristics and experimental requirements. Actual solubility may vary depending on solvent selection, concentration, temperature, and laboratory conditions. |
Technical Specifications
| Appearance | White Lyophilized Powder |
| Purity | ≥98.6% (Actual batch purity may vary according to production testing results) |
| Testing Method | HPLC / Mass Spectrometry |
| Packaging | Multiple vial specifications available |
| Documentation | Certificate of Analysis (COA) and quality testing reports available |
Quality Control & Documentation
Each batch of Retatrutide supplied by Yuansense Peptide undergoes quality verification procedures to ensure reliable product documentation.
Available documentation includes:
- Certificate of Analysis (COA)
- Purity Testing Report
- HPLC Analysis
- Mass Spectrometry Testing
Customers may contact our team to request the latest product documentation and batch information.
Packaging & Bulk Supply
Yuansense Peptide provides flexible supply options for different purchasing requirements.
- Sample orders for laboratory testing
- Multiple vial specifications
- Bulk peptide orders
- Distributor supply programs
- Customized packaging solutions
Sample orders and bulk purchase quantities are available.
For larger quantity requirements, please contact our sales team for bulk pricing and supply availability.
Shipping Information
Yuansense Peptide provides worldwide peptide supply services with secure packaging and documentation support.
Shipping options and delivery arrangements are available according to destination, order quantity, and customer requirements.
Frequently Asked Questions
What purity is available for Retatrutide?
Retatrutide is supplied with high-purity specifications. Actual batch purity may vary according to production testing results, and quality documentation is available upon request.
Do you provide COA for Retatrutide?
Yes. Certificate of Analysis (COA), purity testing reports, and related quality documentation are available for qualified customers.
Can I order bulk Retatrutide?
Yes. Yuansense Peptide supports both sample orders and bulk Retatrutide purchases. Customers requiring larger quantities can contact our sales team for competitive pricing and supply solutions.
What packaging options are available?
Retatrutide is available in multiple vial specifications and packaging options according to order requirements.
How should Retatrutide be stored?
Retatrutide should be stored according to recommended product storage conditions. Specific storage requirements may vary depending on experimental conditions and handling procedures.
Disclaimer
This product is supplied for research use only (RUO).
It is not intended for human consumption, medical use, diagnosis, treatment, or prevention of any disease.
Important Notice
This product is sold strictly for laboratory research purposes only.It is not intended for human consumption, medical use, or clinical application. By purchasing this product, the buyer confirms that it will be used solely for lawful scientific research.
Share

Research Use Only
This product is intended for research purposes only and is not for human consumption, therapeutic use, or diagnostic applications. Please ensure compliance with all applicable regulations and institutional guidelines.