yuansensetech
Sermorelin Acetate
Sermorelin Acetate
SKU:SMO5
Couldn't load pickup availability
Product Description
Overview
Sermorelin Acetate is a synthetic peptide research material supplied by Yuansense Peptide for laboratory and professional research applications.
Sermorelin is a 29-amino-acid peptide analog corresponding to the N-terminal fragment of human growth hormone-releasing hormone (GHRH). It is widely studied in peptide chemistry, hormone signaling research, receptor interaction studies, and molecular biology research.
Sermorelin Acetate is supplied in acetate salt form, which is commonly used for peptide stability and handling. Yuansense Peptide provides high-purity Sermorelin Acetate with supporting quality documentation, including Certificate of Analysis (COA), HPLC testing, and mass spectrometry analysis.
Flexible supply options are available for research institutions, distributors, and professional buyers, including sample orders and bulk peptide supply programs.
Product Information
| CAS Number: | 86168-78-7 |
| PubChem CID: | 16129604 |
| Molecular Formula: | C149H246N44O42S |
| Molecular Weight: | 3357.96 g/mol |
| Purity: | ≥98.6% (Actual batch purity may vary according to production testing results) |
| Sequence: | YADAIFTNSYRKVLGQLSARKLLQDIMSR |
| Form: | Lyophilized powder (Acetate Salt) |
| Storage: | Store at -20°C or below for long-term storage, protected from light and moisture. Storage conditions may vary depending on product characteristics, handling procedures, and specific experimental requirements. |
| Solubility: | Soluble in water or suitable laboratory buffers. Actual solubility may vary depending on concentration, solvent selection, temperature, and laboratory conditions. |
Technical Specifications
| Peptide Type: | Synthetic Growth Hormone Releasing Hormone (GHRH) Analog |
| Peptide Length: | 29 Amino Acids |
| Origin: | Human GHRH (1-29) Analog Sequence |
| Salt Form: | Acetate Salt |
| Appearance: | White Lyophilized Powder |
| Purity: | ≥98.6% (Actual batch purity may vary according to production testing results) |
| Testing Method: | HPLC / Mass Spectrometry |
| Documentation: | Certificate of Analysis (COA), HPLC Testing Report, Mass Spectrometry Data |
Research Applications
- GHRH Signaling Research: Used as a research compound for studying growth hormone-releasing hormone receptor interactions and signaling pathways.
- Peptide-Receptor Studies: Applied in molecular research involving peptide binding and receptor activity analysis.
- Hormone Biology Research: Used in laboratory investigations of peptide hormone mechanisms and related biochemical pathways.
- Peptide Characterization: Suitable for analytical studies involving peptide structure, purity evaluation, and synthesis verification.
Quality Control & Documentation
Each batch of Sermorelin Acetate supplied by Yuansense Peptide undergoes quality verification procedures to ensure product consistency and documentation reliability.
- Certificate of Analysis (COA)
- HPLC Purity Testing Report
- Mass Spectrometry Testing Data
- Batch Quality Documentation
Customers may contact our team to request the latest batch documentation.
Packaging & Bulk Supply
Yuansense Peptide provides flexible supply options for Sermorelin Acetate research material.
- Sample orders for laboratory evaluation
- Multiple vial specifications available
- Bulk peptide supply programs
- Distributor cooperation
- Customized packaging solutions
For larger quantity requirements, please contact our sales team for bulk pricing and supply availability.
Frequently Asked Questions
What is Sermorelin Acetate peptide?
Sermorelin Acetate is a synthetic 29-amino-acid peptide research material based on the N-terminal sequence of human growth hormone-releasing hormone (GHRH).
What is the sequence of Sermorelin?
The Sermorelin peptide sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR.
What is the molecular weight of Sermorelin Acetate?
The molecular weight of Sermorelin peptide is approximately 3357.96 g/mol.
Do you provide COA for Sermorelin Acetate?
Yes. Certificate of Analysis (COA), HPLC reports, and mass spectrometry documentation are available upon request.
Can I order bulk Sermorelin Acetate?
Yes. Yuansense Peptide supports sample orders and bulk peptide supply programs. Larger quantity buyers can contact our sales team for pricing and availability.
Disclaimer
This product is supplied for research use only (RUO).
It is not intended for human consumption, medical use, diagnosis, treatment, or prevention of any disease.
Important Notice
This product is sold strictly for laboratory research purposes only.It is not intended for human consumption, medical use, or clinical application. By purchasing this product, the buyer confirms that it will be used solely for lawful scientific research.
Research Use Only
This product is intended for research purposes only and is not for human consumption, therapeutic use, or diagnostic applications. Please ensure compliance with all applicable regulations and institutional guidelines.