yuansensetech
Tesamorelin (Tesa)
Tesamorelin (Tesa)
5.0 / 5.0
(1) 1 total reviews
Couldn't load pickup availability
Product Description
Overview
Tesamorelin (also known as Tesa) is a synthetic research peptide, a stabilized analogue of human growth hormone-releasing hormone (GHRH). Tesamorelin peptide consists of the full 44-amino acid GHRH sequence with a trans-3-hexenoic acid modification at the N-terminal tyrosine for enhanced stability. This TESA peptide is classified as a GHRH analog and somatotropin agonist, FDA-approved for reduction of excess abdominal fat in HIV-infected patients with lipodystrophy and widely studied for growth hormone dynamics and metabolism research.
Mechanism of Action
Tesamorelin binds to the growth hormone-releasing hormone receptor (GHRH-R) on somatotroph cells in the anterior pituitary gland, mimicking the action of endogenous GHRH. This receptor binding stimulates the synthesis and pulsatile release of endogenous growth hormone (GH), which in turn elevates circulating levels of insulin-like growth factor 1 (IGF-1). Through this mechanism, tesamorelin promotes metabolic effects including reduction of visceral adipose tissue (VAT), improvement of lipid profiles, and maintenance of glucose homeostasis.
Research Applications
- Metabolic and Body Composition Studies: Investigated for its effects on visceral fat reduction, lean body mass, and lipid metabolism.
- Growth Hormone Axis Research: Employed as a research tool to study GHRH receptor signaling, GH secretion dynamics, and IGF-1 regulation.
- HIV-Associated Lipodystrophy: Studied for the treatment of excess abdominal fat in HIV-infected patients with lipodystrophy.
- Neurocognitive Research: Explored for potential effects on neurocognitive impairment.
Product Specifications
CAS Number: 218949-48-5
Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight: ~5,135.8–5,195.9 g/mol
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Purity: ≥ 99% (batch-dependent; refer to Certificate of Analysis)
Form: White to off-white lyophilized powder
Storage: Store at ≤ -20°C in a cool, dry place, protected from light and moisture
Solubility: Soluble in sterile water and DMSO; prepare working solutions per laboratory protocol
Share

Top-notch purity and quality.
Research Use Only
This product is intended for research purposes only and is not for human consumption, therapeutic use, or diagnostic applications. Please ensure compliance with all applicable regulations and institutional guidelines.